Lineage for d2czzx_ (2czz X:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453923Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2453931Protein Hypothetical protein PH1109 [141934] (1 species)
  7. 2453932Species Pyrococcus horikoshii [TaxId:53953] [141935] (4 PDB entries)
    Uniprot O58836 1-142
  8. 2453935Domain d2czzx_: 2czz X: [303700]
    automated match to d2d5aa_
    complexed with ca, cl, coa

Details for d2czzx_

PDB Entry: 2czz (more details), 1.8 Å

PDB Description: Crystal structure of hypothetical protein PH1109 from pyrococcus horikoshii
PDB Compounds: (X:) hypothetical protein PH1109

SCOPe Domain Sequences for d2czzx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czzx_ c.2.1.8 (X:) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]}
meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkye
evlgrkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskka
deagliivanrcmmreherllg

SCOPe Domain Coordinates for d2czzx_:

Click to download the PDB-style file with coordinates for d2czzx_.
(The format of our PDB-style files is described here.)

Timeline for d2czzx_: