SCOPe 2.07: Domain d1xtxa1: 1xtx A:6-121

Lineage for d1xtxa1 (1xtx A:6-121)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.2: PDI-like [52849] (3 proteins)
   duplication: contains two tandem repeats of this fold

6. Protein automated matches [254585] (1 species)
   not a true protein

7. Species Fungus (Humicola insolens) [TaxId:34413] [255369] (4 PDB entries)

8. Domain d1xtxa1: 1xtx A:6-121 [303371]
   Other proteins in same PDB: d1xtxa2
   automated match to d2kp1a_

Details for d1xtxa1

PDB Entry: 1xtx

PDB Description: Solution structure of the a' domain of thermophilic fungal protein disulfide isomerase

PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d1xtxa1:

Sequence; same for both SEQRES and ATOM records:

>d1xtxa1 c.47.1.2 (A:6-121) automated matches {Fungus (Humicola insolens) [TaxId: 34413]}
egpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefkdrvvi
akvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkykaa

Timeline for d1xtxa1:

• d1xtxa1 first appeared in SCOPe 2.06
  
• d1xtxa1 appears in the current release, SCOPe 2.08