Lineage for d1h7wb3 (1h7w B:288-440)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1581823Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1581824Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1581825Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 1581838Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)
  7. 1581839Species Pig (Sus scrofa) [TaxId:9823] [51912] (5 PDB entries)
  8. 1581845Domain d1h7wb3: 1h7w B:288-440 [30325]
    Other proteins in same PDB: d1h7wa1, d1h7wa2, d1h7wa4, d1h7wa5, d1h7wb1, d1h7wb2, d1h7wb4, d1h7wb5, d1h7wc1, d1h7wc2, d1h7wc4, d1h7wc5, d1h7wd1, d1h7wd2, d1h7wd4, d1h7wd5
    complexed with fad, fmn, sf4

Details for d1h7wb3

PDB Entry: 1h7w (more details), 1.9 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig
PDB Compounds: (B:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1h7wb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7wb3 c.3.1.1 (B:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

SCOPe Domain Coordinates for d1h7wb3:

Click to download the PDB-style file with coordinates for d1h7wb3.
(The format of our PDB-style files is described here.)

Timeline for d1h7wb3: