SCOPe 2.08: Domain d1vfka4: 1vfk A:1-120

Lineage for d1vfka4 (1vfk A:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (12 PDB entries)

8. Domain d1vfka4: 1vfk A:1-120 [303222]
   Other proteins in same PDB: d1vfka5, d1vfka6, d1vfkb5, d1vfkb6
   automated match to d1bvza1
   complexed with ca, glc
   has additional insertions and/or extensions that are not grouped together

Details for d1vfka4

PDB Entry: 1vfk, 2.9 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 alpha-amylase 2/acarbose complex

PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d1vfka4:

Sequence; same for both SEQRES and ATOM records:

>d1vfka4 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1vfka4:

• d1vfka4 first appeared in SCOPe 2.06
  
• d1vfka4 appears in SCOPe 2.07