Lineage for d1djqb2 (1djq B:490-645)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1581823Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1581824Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1581825Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. Protein Trimethylamine dehydrogenase, C-terminal domain [51907] (1 species)
    N-terminal domain is beta/alpha barrel and the middle domain is alpha/beta Rossmann-fold
  7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [51908] (5 PDB entries)
  8. 1581871Domain d1djqb2: 1djq B:490-645 [30316]
    Other proteins in same PDB: d1djqa1, d1djqa3, d1djqb1, d1djqb3
    complexed with adp, fmn, sf4; mutant

Details for d1djqb2

PDB Entry: 1djq (more details), 2.2 Å

PDB Description: structural and biochemical characterization of recombinant c30a mutant of trimethylamine dehydrogenase from methylophilus methylotrophus (sp. w3a1)
PDB Compounds: (B:) trimethylamine dehydrogenase

SCOPe Domain Sequences for d1djqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djqb2 c.3.1.1 (B:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
rwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyfmapslaekl
ataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepgrmeiyniwg
dgskrtyrgpgvsprdantshrwiefdslvlvtgrh

SCOPe Domain Coordinates for d1djqb2:

Click to download the PDB-style file with coordinates for d1djqb2.
(The format of our PDB-style files is described here.)

Timeline for d1djqb2: