Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein automated matches [196844] (6 species) not a true protein |
Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries) |
Domain d1um3a_: 1um3 A: [303144] Other proteins in same PDB: d1um3b_, d1um3d1, d1um3d2, d1um3f_, d1um3h_, d1um3o_, d1um3q1, d1um3q2, d1um3s_, d1um3t_, d1um3u_ automated match to d2e74a_ complexed with bcr, cla, fes, hem, opc, pl9, tds |
PDB Entry: 1um3 (more details), 3 Å
SCOPe Domain Sequences for d1um3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1um3a_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]} eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp wliavfmllhflmirkqgisgp
Timeline for d1um3a_: