Lineage for d1ty3l4 (1ty3 L:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752814Domain d1ty3l4: 1ty3 L:108-214 [303119]
    Other proteins in same PDB: d1ty3a_, d1ty3b4, d1ty3b5, d1ty3b6, d1ty3h_, d1ty3l3
    automated match to d1tqbc2
    complexed with ca, cac, gol, mg, nag, ndg

Details for d1ty3l4

PDB Entry: 1ty3 (more details), 2.8 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d1ty3l4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty3l4 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1ty3l4:

Click to download the PDB-style file with coordinates for d1ty3l4.
(The format of our PDB-style files is described here.)

Timeline for d1ty3l4: