Lineage for d1txvb6 (1txv B:107-354)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500076Protein Integrin beta A domain [69542] (1 species)
  7. 2500077Species Human (Homo sapiens) [TaxId:9606] [69543] (9 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 2500078Domain d1txvb6: 1txv B:107-354 [303106]
    Other proteins in same PDB: d1txva_, d1txvb4, d1txvb5, d1txvl3, d1txvl4
    automated match to d1tyed2
    complexed with ca, cac, gol, mg, nag, ndg

Details for d1txvb6

PDB Entry: 1txv (more details), 2.75 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
PDB Compounds: (B:) integrin beta-3

SCOPe Domain Sequences for d1txvb6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txvb6 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOPe Domain Coordinates for d1txvb6:

Click to download the PDB-style file with coordinates for d1txvb6.
(The format of our PDB-style files is described here.)

Timeline for d1txvb6: