SCOPe 2.07: Domain d1sgxb7: 1sgx B:473-593

Lineage for d1sgxb7 (1sgx B:473-593)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families)
   automatically mapped to Pfam PF00927

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (9 PDB entries)

8. Domain d1sgxb7: 1sgx B:473-593 [303072]
   Other proteins in same PDB: d1sgxa5, d1sgxa6, d1sgxb5, d1sgxb6
   automated match to d1l9ma2
   complexed with 5gp, ca, mg

Details for d1sgxb7

PDB Entry: 1sgx, 2 Å

PDB Description: Crystal Structure of Transglutaminase 3 in Complex with Bound GMP: Structural Basis for Alteration in Nucleotide Specificity

PDB Compounds: (B:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1sgxb7:

Sequence; same for both SEQRES and ATOM records:

>d1sgxb7 b.1.5.1 (B:473-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
leteeqepsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhe
vwkdsatmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiild
n

Timeline for d1sgxb7:

• d1sgxb7 first appeared in SCOPe 2.06
  
• d1sgxb7 appears in the current release, SCOPe 2.08