Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (9 PDB entries) |
Domain d1sgxb7: 1sgx B:473-593 [303072] Other proteins in same PDB: d1sgxa5, d1sgxa6, d1sgxb5, d1sgxb6 automated match to d1l9ma2 complexed with 5gp, ca, mg |
PDB Entry: 1sgx (more details), 2 Å
SCOPe Domain Sequences for d1sgxb7:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgxb7 b.1.5.1 (B:473-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]} leteeqepsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhe vwkdsatmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiild n
Timeline for d1sgxb7:
View in 3D Domains from other chains: (mouse over for more information) d1sgxa5, d1sgxa6, d1sgxa7, d1sgxa8 |