Lineage for d1scth_ (1sct H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2301943Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)
  8. 2301961Domain d1scth_: 1sct H: [303061]
    automated match to d4hrrb_
    complexed with cmo, hem

Details for d1scth_

PDB Entry: 1sct (more details), 2 Å

PDB Description: scapharca tetrameric hemoglobin, co-state
PDB Compounds: (H:) hemoglobin II (carbonmonoxy) (beta chain)

SCOPe Domain Sequences for d1scth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scth_ a.1.1.2 (H:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
kvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvsa
gkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgplr
qtlkarmgnyfdedtvaawaslvavvqasl

SCOPe Domain Coordinates for d1scth_:

Click to download the PDB-style file with coordinates for d1scth_.
(The format of our PDB-style files is described here.)

Timeline for d1scth_: