Lineage for d1q26a_ (1q26 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448747Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2448748Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 2448749Protein Dihydropteroate synthetase [51719] (5 species)
  7. 2448750Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries)
    Uniprot Q81VW8
  8. 2448755Domain d1q26a_: 1q26 A: [302906]
    automated match to d4nirb_
    complexed with so4

Details for d1q26a_

PDB Entry: 1q26 (more details), 2.2 Å

PDB Description: Dihydropteroate synthase from Bacillus anthracis
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d1q26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q26a_ c.1.21.1 (A:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

SCOPe Domain Coordinates for d1q26a_:

Click to download the PDB-style file with coordinates for d1q26a_.
(The format of our PDB-style files is described here.)

Timeline for d1q26a_: