![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) ![]() |
![]() | Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
![]() | Protein Dihydropteroate synthetase [51719] (5 species) |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries) Uniprot Q81VW8 |
![]() | Domain d1q26a_: 1q26 A: [302906] automated match to d4nirb_ complexed with so4 |
PDB Entry: 1q26 (more details), 2.2 Å
SCOPe Domain Sequences for d1q26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q26a_ c.1.21.1 (A:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat vclgiekgcefvrvhdvkemsrmakmmdamigk
Timeline for d1q26a_: