Lineage for d1liwc4 (1liw C:57-159,C:262-439)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2837914Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2837915Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2837936Species Human (Homo sapiens) [TaxId:9606] [82273] (8 PDB entries)
  8. 2837959Domain d1liwc4: 1liw C:57-159,C:262-439 [302690]
    Other proteins in same PDB: d1liwa5, d1liwa6, d1liwb5, d1liwc5, d1liwc6
    automated match to d2vgfa2
    complexed with fbp, k, mn, pga; mutant

Details for d1liwc4

PDB Entry: 1liw (more details), 2.75 Å

PDB Description: Human erythrocyte pyruvate kinase: Thr384Met mutant
PDB Compounds: (C:) Pyruvate kinase, isozymes R/L

SCOPe Domain Sequences for d1liwc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liwc4 c.1.12.1 (C:57-159,C:262-439) Pyruvate kinase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgXpglseqdvrdlrfgve
hgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvar
gdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkprpmraetsdvanavld
gadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfe

SCOPe Domain Coordinates for d1liwc4:

Click to download the PDB-style file with coordinates for d1liwc4.
(The format of our PDB-style files is described here.)

Timeline for d1liwc4: