Lineage for d1bura4 (1bur A:148-475)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447081Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2447082Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2447083Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2447209Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (11 PDB entries)
  8. 2447214Domain d1bura4: 1bur A:148-475 [302248]
    Other proteins in same PDB: d1bura3, d1burb3, d1burc3, d1burd3, d1burs_, d1burt_, d1buru_, d1burv_
    automated match to d8ruca1
    complexed with cap, mg

Details for d1bura4

PDB Entry: 1bur (more details), 1.8 Å

PDB Description: ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg2+ and 2-carboxyarabinitol-1,5-bisphosphate
PDB Compounds: (A:) ribulose 1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1bura4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bura4 c.1.14.1 (A:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOPe Domain Coordinates for d1bura4:

Click to download the PDB-style file with coordinates for d1bura4.
(The format of our PDB-style files is described here.)

Timeline for d1bura4: