SCOPe 2.08: Domain d1bjyb4: 1bjy B:68-208

Lineage for d1bjyb4 (1bjy B:68-208)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)

7. Species Escherichia coli [TaxId:562] [48501] (37 PDB entries)

8. Domain d1bjyb4: 1bjy B:68-208 [302229]
   Other proteins in same PDB: d1bjya3, d1bjya5, d1bjyb3, d1bjyb5
   automated match to d1bjza2
   complexed with ctc, mg

Details for d1bjyb4

PDB Entry: 1bjy, 2.7 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction

PDB Compounds: (B:) tetracycline repressor

SCOPe Domain Sequences for d1bjyb4:

Sequence, based on SEQRES records:

>d1bjyb4 a.121.1.1 (B:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records):

>d1bjyb4 a.121.1.1 (B:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaalnlppllrealqimdsddgeqaflhgleslirg
fevqltallqiv

Timeline for d1bjyb4:

• d1bjyb4 first appeared in SCOPe 2.06
  
• d1bjyb4 appears in SCOPe 2.07