![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Glutamate dehydrogenase [51884] (8 species) |
![]() | Species Clostridium symbiosum [TaxId:1512] [51885] (4 PDB entries) |
![]() | Domain d1hrda1: 1hrd A:195-449 [30219] Other proteins in same PDB: d1hrda2, d1hrdb2, d1hrdc2 |
PDB Entry: 1hrd (more details), 1.96 Å
SCOPe Domain Sequences for d1hrda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hrda1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} karsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgnvawgaakklaelga kavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfgvqffpgekpwgqkv diimpcatqndvdleqakkivannvkyyievanmpttnealrflmqqpnmvvapskavna ggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaeryglgynlvaganivg fqkiadammaqgiaw
Timeline for d1hrda1:
![]() Domains from other chains: (mouse over for more information) d1hrdb1, d1hrdb2, d1hrdc1, d1hrdc2 |