SCOP 1.67: Domain d1llc_1: 1llc 13-164

Lineage for d1llc_1 (1llc 13-164)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)

6. Protein Lactate dehydrogenase [51859] (13 species)

7. Species Lactobacillus casei [TaxId:1582] [51865] (1 PDB entry)

8. Domain d1llc_1: 1llc 13-164 [30176]
   Other proteins in same PDB: d1llc_2
   complexed with fbp, so4

Details for d1llc_1

PDB Entry: 1llc, 3 Å

PDB Description: structure determination of the allosteric l-lactate dehydrogenase from lactobacillus casei at 3.0 angstroms resolution

SCOP Domain Sequences for d1llc_1:

Sequence; same for both SEQRES and ATOM records:

>d1llc_1 c.2.1.5 (13-164) Lactate dehydrogenase {Lactobacillus casei}
asitdkdhqkvilvgdgavgssyafamvlqgiaqeigivdifkdktkgdaidlsnalpft
spkkiysaeysdakdadlvvitagapkqpgetrldlvnknlkilksivdpivdsgfnlif
lvaanpvdiltyatwklsgfpknrvvgsg

Timeline for d1llc_1:

• d1llc_1 first appeared (with stable ids) in SCOP 1.55
  
• d1llc_1 appears in SCOP 1.65
  
• d1llc_1 appears in SCOP 1.69
  
• d1llc_1 appears in the current release, SCOPe 2.08, called d1llca1