Lineage for d1hyhd1 (1hyh D:21-166)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1348919Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1348952Protein L-2-hydroxyisocapronate dehydrogenase, L-HICDH [51857] (1 species)
  7. 1348953Species Lactobacillus confusus [TaxId:1583] [51858] (1 PDB entry)
  8. 1348957Domain d1hyhd1: 1hyh D:21-166 [30153]
    Other proteins in same PDB: d1hyha2, d1hyhb2, d1hyhc2, d1hyhd2
    complexed with nad, so4

Details for d1hyhd1

PDB Entry: 1hyh (more details), 2.2 Å

PDB Description: crystal structure of l-2-hydroxyisocaproate dehydrogenase from lactobacillus confusus at 2.2 angstroms resolution-an example of strong asymmetry between subunits
PDB Compounds: (D:) l-2-hydroxyisocaproate dehydrogenase

SCOPe Domain Sequences for d1hyhd1:

Sequence, based on SEQRES records: (download)

>d1hyhd1 c.2.1.5 (D:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv
isnpvdvitalfqhvtgfpahkvigt

Sequence, based on observed residues (ATOM records): (download)

>d1hyhd1 c.2.1.5 (D:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlggdrfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdvita
lfqhvtgfpahkvigt

SCOPe Domain Coordinates for d1hyhd1:

Click to download the PDB-style file with coordinates for d1hyhd1.
(The format of our PDB-style files is described here.)

Timeline for d1hyhd1: