Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [261289] (1 PDB entry) |
Domain d4to8b1: 4to8 B:2-286 [300800] Other proteins in same PDB: d4to8a2, d4to8b2 automated match to d4to8a_ complexed with flc, zn |
PDB Entry: 4to8 (more details), 2.1 Å
SCOPe Domain Sequences for d4to8b1:
Sequence, based on SEQRES records: (download)
>d4to8b1 c.1.10.0 (B:2-286) automated matches {Staphylococcus aureus [TaxId: 1280]} plvsmkemlidakengyavgqyninnleftqaileasqeenapvilgvsegaarymsgfy tivkmveglmhdlnitipvaihldhgssfekckeaidagftsvmidashspfeenvattk kvveyahekgvsveaelgtvggqeddvvadgiiyadpkecqelvektgidalapalgsvh gpykgepklgfkemeeiglstglplvlhggtgiptkdiqkaipfgtakinvntenqiasa kavrdvlnndkevydprkylgpareaiketvkgkikefgtsnrak
>d4to8b1 c.1.10.0 (B:2-286) automated matches {Staphylococcus aureus [TaxId: 1280]} plvsmkemlidakengyavgqyninnleftqaileasqeenapvilgvsegaarymsgfy tivkmveglmhdlnitipvaihldhgssfekckeaidagftsvmidashspfeenvattk kvveyahekgvsveaelgtvggddvvadgiiyadpkecqelvektgidalapalgsvhpk lgfkemeeiglstglplvlhggtgiptkdiqkaipfgtakinvntenqiasakavrdvln ndkevydprkylgpareaiketvkgkikefgtsnrak
Timeline for d4to8b1: