Lineage for d1arza1 (1arz A:4-130,A:241-273)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387801Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 387852Protein Dihydrodipicolinate reductase [51821] (2 species)
  7. 387853Species Escherichia coli [TaxId:562] [51822] (5 PDB entries)
  8. 387858Domain d1arza1: 1arz A:4-130,A:241-273 [30059]
    Other proteins in same PDB: d1arza2, d1arzb2, d1arzc2, d1arzd2

Details for d1arza1

PDB Entry: 1arz (more details), 2.6 Å

PDB Description: escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate

SCOP Domain Sequences for d1arza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arza1 c.2.1.3 (A:4-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli}
anirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtvq
ssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadiai
vfaanfsXmtfangavrsalwlsgkesglfdmrdvldlnnl

SCOP Domain Coordinates for d1arza1:

Click to download the PDB-style file with coordinates for d1arza1.
(The format of our PDB-style files is described here.)

Timeline for d1arza1: