SCOPe 2.03: Domain d1diha1: 1dih A:2-130,A:241-273

Lineage for d1diha1 (1dih A:2-130,A:241-273)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Dihydrodipicolinate reductase [51821] (3 species)

7. Species Escherichia coli [TaxId:562] [51822] (5 PDB entries)

8. Domain d1diha1: 1dih A:2-130,A:241-273 [30056]
   Other proteins in same PDB: d1diha2
   complexed with ndp

Details for d1diha1

PDB Entry: 1dih, 2.2 Å

PDB Description: three-dimensional structure of e. coli dihydrodipicolinate reductase

PDB Compounds: (A:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1diha1:

Sequence; same for both SEQRES and ATOM records:

>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}
hdanirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvt
vqssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadi
aivfaanfsXmtfangavrsalwlsgkesglfdmrdvldlnnl

Timeline for d1diha1:

• d1diha1 first appeared (with stable ids) in SCOP 1.55, called d1dih_1
  
• d1diha1 appears in SCOPe 2.02
  
• d1diha1 appears in SCOPe 2.04
  
• d1diha1 appears in the current release, SCOPe 2.08