SCOP 1.65: Domain d1dih_1: 1dih 2-130,241-273

Lineage for d1dih_1 (1dih 2-130,241-273)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Dihydrodipicolinate reductase [51821] (1 species)

7. Species Escherichia coli [TaxId:562] [51822] (5 PDB entries)

8. Domain d1dih_1: 1dih 2-130,241-273 [30056]
   Other proteins in same PDB: d1dih_2
   complexed with ndp

Details for d1dih_1

PDB Entry: 1dih, 2.2 Å

PDB Description: three-dimensional structure of e. coli dihydrodipicolinate reductase

SCOP Domain Sequences for d1dih_1:

Sequence; same for both SEQRES and ATOM records:

>d1dih_1 c.2.1.3 (2-130,241-273) Dihydrodipicolinate reductase {Escherichia coli}
hdanirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvt
vqssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadi
aivfaanfsXmtfangavrsalwlsgkesglfdmrdvldlnnl

Timeline for d1dih_1:

• d1dih_1 first appeared (with stable ids) in SCOP 1.55
  
• d1dih_1 appears in SCOP 1.63
  
• d1dih_1 appears in SCOP 1.67
  
• d1dih_1 appears in the current release, SCOPe 2.08, called d1diha1