Lineage for d1d1ta2 (1d1t A:175-324)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 19979Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 19980Protein Alcohol dehydrogenase [51737] (4 species)
  7. 20031Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (13 PDB entries)
  8. 20040Domain d1d1ta2: 1d1t A:175-324 [29735]
    Other proteins in same PDB: d1d1ta1, d1d1tb1, d1d1tc1, d1d1td1

Details for d1d1ta2

PDB Entry: 1d1t (more details), 2.4 Å

PDB Description: mutant of human sigma alcohol dehydrogenase with leucine at position 141

SCOP Domain Sequences for d1d1ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ta2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gfstgygaavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekama
vgatecispkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgv
ppsakmltydpmllftgrtwkgcvfgglks

SCOP Domain Coordinates for d1d1ta2:

Click to download the PDB-style file with coordinates for d1d1ta2.
(The format of our PDB-style files is described here.)

Timeline for d1d1ta2: