![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins) N-terminal all-beta domain defines family |
![]() | Protein Alcohol dehydrogenase [51737] (9 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [51738] (40 PDB entries) Uniprot P00327 |
![]() | Domain d1axgb2: 1axg B:164-339 [29708] Other proteins in same PDB: d1axga1, d1axgb1, d1axgc1, d1axgd1 complexed with etf, nad, zn; mutant |
PDB Entry: 1axg (more details), 2.5 Å
SCOPe Domain Sequences for d1axgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axgb2 c.2.1.1 (B:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} splekvcligcgfstgygsavkvakvtqgstcavfglggaglsvimgckaagaariigvd inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk
Timeline for d1axgb2: