Lineage for d1axeb2 (1axe B:164-339)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576365Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 1576383Protein Alcohol dehydrogenase [51737] (9 species)
  7. 1576400Species Horse (Equus caballus) [TaxId:9796] [51738] (40 PDB entries)
    Uniprot P00327
  8. 1576453Domain d1axeb2: 1axe B:164-339 [29698]
    Other proteins in same PDB: d1axea1, d1axeb1
    complexed with etf, nad, zn; mutant

Details for d1axeb2

PDB Entry: 1axe (more details), 2 Å

PDB Description: crystal structure of the active-site mutant phe93->trp of horse liver alcohol dehydrogenase in complex with nad and inhibitor trifluoroethanol
PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1axeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axeb2 c.2.1.1 (B:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d1axeb2:

Click to download the PDB-style file with coordinates for d1axeb2.
(The format of our PDB-style files is described here.)

Timeline for d1axeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axeb1