Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins) N-terminal all-beta domain defines family |
Protein Alcohol dehydrogenase [51737] (9 species) |
Species Horse (Equus caballus) [TaxId:9796] [51738] (36 PDB entries) |
Domain d1btob2: 1bto B:164-339 [29694] Other proteins in same PDB: d1btoa1, d1btob1, d1btoc1, d1btod1 |
PDB Entry: 1bto (more details), 2 Å
SCOP Domain Sequences for d1btob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btob2 c.2.1.1 (B:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk
Timeline for d1btob2: