Lineage for d1brlb_ (1brl B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575382Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 1575383Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins)
    typical (beta/alpha)8-barrel fold
    heterodimer of two similar chains
  6. 1575389Protein Bacterial luciferase beta chain, LuxB [88707] (1 species)
  7. 1575390Species Vibrio harveyi [TaxId:669] [88708] (4 PDB entries)
  8. 1575396Domain d1brlb_: 1brl B: [29554]
    Other proteins in same PDB: d1brla_, d1brlc_
    heterodimer with alpha chain
    complexed with po4

Details for d1brlb_

PDB Entry: 1brl (more details), 2.4 Å

PDB Description: three-dimensional structure of bacterial luciferase from vibrio harveyi at 2.4 angstroms resolution
PDB Compounds: (B:) bacterial luciferase

SCOPe Domain Sequences for d1brlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brlb_ c.1.16.1 (B:) Bacterial luciferase beta chain, LuxB {Vibrio harveyi [TaxId: 669]}
mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
smedkaqqravidvvnani

SCOPe Domain Coordinates for d1brlb_:

Click to download the PDB-style file with coordinates for d1brlb_.
(The format of our PDB-style files is described here.)

Timeline for d1brlb_: