Lineage for d1pklf2 (1pkl F:1-87,F:187-357)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2446508Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2446509Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2446510Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2446613Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51626] (11 PDB entries)
  8. 2446639Domain d1pklf2: 1pkl F:1-87,F:187-357 [29285]
    Other proteins in same PDB: d1pkla1, d1pkla3, d1pklb1, d1pklb3, d1pklc1, d1pklc3, d1pkld1, d1pkld3, d1pkle1, d1pkle3, d1pklf1, d1pklf3, d1pklg1, d1pklg3, d1pklh1, d1pklh3
    complexed with so4

Details for d1pklf2

PDB Entry: 1pkl (more details), 2.35 Å

PDB Description: the structure of leishmania pyruvate kinase
PDB Compounds: (F:) protein (pyruvate kinase)

SCOPe Domain Sequences for d1pklf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pklf2 c.1.12.1 (F:1-87,F:187-357) Pyruvate kinase, N-terminal domain {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
qttinnvrqaaaelgvniaialdtkgpXpavsakdrvdlqfgveqgvdmifasfirsaeq
vgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvvaq
kiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgky
pnevvqymaricleaqsal

SCOPe Domain Coordinates for d1pklf2:

Click to download the PDB-style file with coordinates for d1pklf2.
(The format of our PDB-style files is described here.)

Timeline for d1pklf2: