SCOP 1.73: Domain d1a4lb_: 1a4l B:

Lineage for d1a4lb_ (1a4l B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins)

6. Protein Adenosine deaminase (ADA) [51558] (3 species)
   Common fold covers the whole protein structure

7. Species Mouse (Mus musculus) [TaxId:10090] [51559] (8 PDB entries)

8. Domain d1a4lb_: 1a4l B: [29024]

Details for d1a4lb_

PDB Entry: 1a4l, 2.6 Å

PDB Description: ada structure complexed with deoxycoformycin at ph 7.0

PDB Compounds: (B:) adenosine deaminase

SCOP Domain Sequences for d1a4lb_:

Sequence; same for both SEQRES and ATOM records:

>d1a4lb_ c.1.9.1 (B:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

Timeline for d1a4lb_:

• d1a4lb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a4lb_ appears in SCOP 1.71
  
• d1a4lb_ appears in SCOP 1.75
  
• d1a4lb_ appears in the current release, SCOPe 2.08