Lineage for d1d2ka1 (1d2k A:36-292,A:355-427)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 19083Family c.1.8.5: Type II chitinase [51534] (6 proteins)
  6. 19084Protein Chitinase 1 [51548] (1 species)
  7. 19085Species Fungus (Coccidioides immitis) [TaxId:5501] [51549] (1 PDB entry)
  8. 19086Domain d1d2ka1: 1d2k A:36-292,A:355-427 [29008]
    Other proteins in same PDB: d1d2ka2

Details for d1d2ka1

PDB Entry: 1d2k (more details), 2.2 Å

PDB Description: c. immitis chitinase 1 at 2.2 angstroms resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1d2ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ka1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis)}
ggfrsvvyfvnwaiygrghnpqdlkadqfthilyafanirpsgevylsdtwadtdkhypg
dkwdepgnnvygcikqmyllkknnrnlktllsiggwtyspnfktpasteegrkkfadtsl
klmkdlgfdgididweypedekqandfvlllkacrealdaysakhpngkkflltiaspag
pqnynklklaemdkyldfwnlmaydfsgswdkvsghmsnvfpsttkpestpfssdkavkd
yikagvpankivlgmplXdtvkiagkkaeyitkngmgggmwwesssdktgneslvgtvvn
glggtgkleqrenelsypesvydnlkngmps

SCOP Domain Coordinates for d1d2ka1:

Click to download the PDB-style file with coordinates for d1d2ka1.
(The format of our PDB-style files is described here.)

Timeline for d1d2ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d2ka2