Lineage for d1clxc_ (1clx C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474407Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 474700Protein Xylanase A, catalytic core [51514] (8 species)
  7. 474721Species Pseudomonas fluorescens [TaxId:294] [51517] (3 PDB entries)
  8. 474724Domain d1clxc_: 1clx C: [28901]

Details for d1clxc_

PDB Entry: 1clx (more details), 1.8 Å

PDB Description: catalytic core of xylanase a

SCOP Domain Sequences for d1clxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clxc_ c.1.8.3 (C:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals

SCOP Domain Coordinates for d1clxc_:

Click to download the PDB-style file with coordinates for d1clxc_.
(The format of our PDB-style files is described here.)

Timeline for d1clxc_: