Lineage for d1f4hb5 (1f4h B:334-625)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116528Family c.1.8.3: beta-glycanases [51487] (13 proteins)
  6. 116533Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 116534Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 116636Domain d1f4hb5: 1f4h B:334-625 [28886]
    Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha3, d1f4ha4, d1f4hb1, d1f4hb2, d1f4hb3, d1f4hb4, d1f4hc1, d1f4hc2, d1f4hc3, d1f4hc4, d1f4hd1, d1f4hd2, d1f4hd3, d1f4hd4

Details for d1f4hb5

PDB Entry: 1f4h (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)

SCOP Domain Sequences for d1f4hb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4hb5 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1f4hb5:

Click to download the PDB-style file with coordinates for d1f4hb5.
(The format of our PDB-style files is described here.)

Timeline for d1f4hb5: