Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.3: beta-glycanases [51487] (26 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (2 species) |
Species Escherichia coli [TaxId:562] [51511] (25 PDB entries) Uniprot P00722 |
Domain d1ghoo5: 1gho O:334-625 [28879] Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghop1, d1ghop2, d1ghop3, d1ghop4 |
PDB Entry: 1gho (more details), 2.5 Å
SCOP Domain Sequences for d1ghoo5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghoo5 c.1.8.3 (O:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1ghoo5:
View in 3D Domains from same chain: (mouse over for more information) d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4 |
View in 3D Domains from other chains: (mouse over for more information) d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghon5, d1ghop1, d1ghop2, d1ghop3, d1ghop4, d1ghop5 |