Lineage for d1bgla5 (1bgl A:334-625)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571449Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 571494Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 571495Species Escherichia coli [TaxId:562] [51511] (25 PDB entries)
  8. 571552Domain d1bgla5: 1bgl A:334-625 [28857]
    Other proteins in same PDB: d1bgla1, d1bgla2, d1bgla3, d1bgla4, d1bglb1, d1bglb2, d1bglb3, d1bglb4, d1bglc1, d1bglc2, d1bglc3, d1bglc4, d1bgld1, d1bgld2, d1bgld3, d1bgld4, d1bgle1, d1bgle2, d1bgle3, d1bgle4, d1bglf1, d1bglf2, d1bglf3, d1bglf4, d1bglg1, d1bglg2, d1bglg3, d1bglg4, d1bglh1, d1bglh2, d1bglh3, d1bglh4

Details for d1bgla5

PDB Entry: 1bgl (more details), 2.5 Å

PDB Description: beta-galactosidase (chains a-h)

SCOP Domain Sequences for d1bgla5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgla5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1bgla5:

Click to download the PDB-style file with coordinates for d1bgla5.
(The format of our PDB-style files is described here.)

Timeline for d1bgla5: