Lineage for d1bf2a3 (1bf2 A:163-637)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339614Protein Isoamylase, central domain [51470] (1 species)
  7. 1339615Species Pseudomonas amyloderamosa [TaxId:32043] [51471] (1 PDB entry)
  8. 1339616Domain d1bf2a3: 1bf2 A:163-637 [28774]
    Other proteins in same PDB: d1bf2a1, d1bf2a2
    complexed with ca

Details for d1bf2a3

PDB Entry: 1bf2 (more details), 2 Å

PDB Description: structure of pseudomonas isoamylase
PDB Compounds: (A:) isoamylase

SCOPe Domain Sequences for d1bf2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]}
pstqstgtkptraqkddviyevhvrgfteqdtsipaqyrgtyygaglkasylaslgvtav
eflpvqetqndandvvpnsdanqnywgymtenyfspdrryaynkaaggptaefqamvqaf
hnagikvymdvvynhtaeggtwtssdpttatiyswrgldnatyyeltsgnqyfydntgig
anfntyntvaqnlivdslaywantmgvdgfrfdlasvlgnsclngaytasapncpnggyn
fdaadsnvainrilreftvrpaaggsgldlfaepwaiggnsyqlggfpqgwsewnglfrd
slrqaqnelgsmtiyvtqdandfsgssnlfqssgrspwnsinfidvhdgmtlkdvyscng
annsqawpygpsdggtstnyswdqgmsagtgaavdqrraartgmafemlsagtplmqggd
eylrtlqcnnnaynldssanwltyswttdqsnfytfaqrliafrkahpalrpssw

SCOPe Domain Coordinates for d1bf2a3:

Click to download the PDB-style file with coordinates for d1bf2a3.
(The format of our PDB-style files is described here.)

Timeline for d1bf2a3: