SCOP 1.69: Domain d1eh9a3: 1eh9 A:91-490

Lineage for d1eh9a3 (1eh9 A:91-490)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (11 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (1 species)
   contains an additional N-terminal domain

7. Species Archaeon Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (2 PDB entries)

8. Domain d1eh9a3: 1eh9 A:91-490 [28772]
   Other proteins in same PDB: d1eh9a1, d1eh9a2

Details for d1eh9a3

PDB Entry: 1eh9, 3 Å

PDB Description: crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase

SCOP Domain Sequences for d1eh9a3:

Sequence; same for both SEQRES and ATOM records:

>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1}
fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw
gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk
yktpwgltfnfddaesdevrkfilenveywikeynvdgfrldavhaiidtspkhileeia
dvvhkynriviaesdlndprvvnpkekcgynidaqwvddfhhsihayltgerqgyytdfg
nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik
lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq
dtdpqdestfnasklswkideeifsfykilikmrkelsia

Timeline for d1eh9a3:

• d1eh9a3 first appeared (with stable ids) in SCOP 1.55
  
• d1eh9a3 appears in SCOP 1.67
  
• d1eh9a3 appears in SCOP 1.71
  
• d1eh9a3 appears in the current release, SCOPe 2.08