| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
| Protein Cyclodextrin glycosyltransferase [51452] (5 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
| Species Bacillus sp. 1011, alkaliphilic [TaxId:1410] [51456] (8 PDB entries) Uniprot P05618 |
| Domain d1dedb4: 1ded B:1-406 [28745] Other proteins in same PDB: d1deda1, d1deda2, d1deda3, d1dedb1, d1dedb2, d1dedb3 complexed with ca has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ded (more details), 2 Å
SCOPe Domain Sequences for d1dedb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dedb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Bacillus sp. 1011, alkaliphilic [TaxId: 1410]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavknmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay
Timeline for d1dedb4:
View in 3DDomains from other chains: (mouse over for more information) d1deda1, d1deda2, d1deda3, d1deda4 |