SCOP 1.63: Domain d1cgx_4: 1cgx 1-406

Lineage for d1cgx_4 (1cgx 1-406)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (21 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (5 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51453] (29 PDB entries)

8. Domain d1cgx_4: 1cgx 1-406 [28726]
   Other proteins in same PDB: d1cgx_1, d1cgx_2, d1cgx_3
   complexed with ca, mal; mutant

Details for d1cgx_4

PDB Entry: 1cgx, 2.59 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

SCOP Domain Sequences for d1cgx_4:

Sequence; same for both SEQRES and ATOM records:

>d1cgx_4 c.1.8.1 (1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlldladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

Timeline for d1cgx_4:

• d1cgx_4 first appeared (with stable ids) in SCOP 1.55
  
• d1cgx_4 appears in SCOP 1.61
  
• d1cgx_4 appears in SCOP 1.65
  
• d1cgx_4 appears in the current release, SCOPe 2.08, called d1cgxa4