Lineage for d1mara_ (1mar A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681974Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 681975Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 682015Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 682016Species Human (Homo sapiens) [TaxId:9606] [51437] (53 PDB entries)
  8. 682056Domain d1mara_: 1mar A: [28678]
    complexed with nap, zst

Details for d1mara_

PDB Entry: 1mar (more details), 1.8 Å

PDB Description: refined 1.8 angstroms structure of human aldose reductase complexed with the potent inhibitor zopolrestat
PDB Compounds: (A:) aldose reductase

SCOP Domain Sequences for d1mara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mara_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
lsctshkdypfheef

SCOP Domain Coordinates for d1mara_:

Click to download the PDB-style file with coordinates for d1mara_.
(The format of our PDB-style files is described here.)

Timeline for d1mara_: