SCOPe 2.08: Domain d1mara_: 1mar A:

Lineage for d1mara_ (1mar A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51437] (156 PDB entries)
   Uniprot P15121

8. Domain d1mara_: 1mar A: [28678]
   complexed with nap, zst

Details for d1mara_

PDB Entry: 1mar, 1.8 Å

PDB Description: refined 1.8 angstroms structure of human aldose reductase complexed with the potent inhibitor zopolrestat

PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d1mara_:

Sequence; same for both SEQRES and ATOM records:

>d1mara_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
lsctshkdypfheef

Timeline for d1mara_:

• d1mara_ first appeared (with stable ids) in SCOP 1.55, called d1mar__
  
• d1mara_ appears in SCOPe 2.07