Lineage for d1d7kb2 (1d7k B:44-283)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173100Superfamily c.1.6: PLP-binding barrel [51419] (2 families) (S)
  5. 173101Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (2 proteins)
  6. 173114Protein Eukaryotic ornithine decarboxylase [51423] (3 species)
  7. 173115Species Human (Homo sapiens) [TaxId:9606] [51424] (1 PDB entry)
  8. 173117Domain d1d7kb2: 1d7k B:44-283 [28649]
    Other proteins in same PDB: d1d7ka1, d1d7kb1

Details for d1d7kb2

PDB Entry: 1d7k (more details), 2.1 Å

PDB Description: crystal structure of human ornithine decarboxylase at 2.1 angstroms resolution

SCOP Domain Sequences for d1d7kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7kb2 c.1.6.1 (B:44-283) Eukaryotic ornithine decarboxylase {Human (Homo sapiens)}
dlgdilkkhlrwlkalprvtpfyavkcndskaivktlaatgtgfdcaskteiqlvqslgv
pperiiyanpckqvsqikyaanngvqmmtfdsevelmkvarahpkaklvlriatddskav
crlsvkfgatlrtsrlllerakelnidvvgvsfhvgsgctdpetfvqaisdarcvfdmga
evgfsmylldigggfpgsedvklkfeeitgvinpaldkyfpsdsgvriiaepgryyvasa

SCOP Domain Coordinates for d1d7kb2:

Click to download the PDB-style file with coordinates for d1d7kb2.
(The format of our PDB-style files is described here.)

Timeline for d1d7kb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d7kb1