Lineage for d1oya__ (1oya -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (9 proteins) 
Protein Old yellow enzyme (OYE) [51401] (2 species) Species Brewer's yeast (Saccharomyces carlsbergensis) [51402] (5 PDB entries) 
Domain d1oya__: 1oya - [28604]
Details for d1oya__
PDB Entry: 1oya (more details), 2 Å
PDB Description: old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
SCOP Domain Sequences for d1oya__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oya__ c.1.4.1 (-) Old yellow enzyme (OYE) {Brewer's yeast (Saccharomyces carlsbergensis)}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlwvlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk
SCOP Domain Coordinates for d1oya__:
Click to download the PDB-style file with coordinates for d1oya__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oya__:
- d1oya__ first appeared (with stable ids) in SCOP 1.55
- d1oya__ appears in SCOP 1.59
- d1oya__ appears in the current release, SCOPe 2.08, called d1oyaa_
View in 3D