Lineage for d2tsya_ (2tsy A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 235793Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 235897Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)
  6. 235921Protein Trp synthase alpha-subunit [51388] (2 species)
  7. 235925Species Salmonella typhimurium [TaxId:90371] [51389] (31 PDB entries)
  8. 235952Domain d2tsya_: 2tsy A: [28583]
    Other proteins in same PDB: d2tsyb_
    complexed with g3p, na, pls; mutant

Details for d2tsya_

PDB Entry: 2tsy (more details), 2.5 Å

PDB Description: crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes

SCOP Domain Sequences for d2tsya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tsya_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknla
spkqmlaelrsfvsamkaasra

SCOP Domain Coordinates for d2tsya_:

Click to download the PDB-style file with coordinates for d2tsya_.
(The format of our PDB-style files is described here.)

Timeline for d2tsya_: