![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.1: alpha-Subunit of urease [51339] (1 protein) |
![]() | Protein alpha-Subunit of urease [51340] (4 species) |
![]() | Species Klebsiella aerogenes [TaxId:28451] [51341] (27 PDB entries) |
![]() | Domain d1fwfc1: 1fwf C:2-129,C:423-475 [28406] Other proteins in same PDB: d1fwfa_, d1fwfb_, d1fwfc2 complexed with ni |
PDB Entry: 1fwf (more details), 2 Å
SCOPe Domain Sequences for d1fwfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwfc1 b.92.1.1 (C:2-129,C:423-475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]} snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa egkivtagXsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy rp
Timeline for d1fwfc1: