Lineage for d1qiub2 (1qiu B:319-395)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810768Fold b.83: Triple beta-spiral [51224] (1 superfamily)
    trimer formed by the interlocking beta-hairpin repeat units
  4. 810769Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (2 families) (S)
  5. 810770Family b.83.1.1: Adenovirus [51226] (1 protein)
  6. 810771Protein Adenovirus [51227] (1 species)
  7. 810772Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries)
    Uniprot P10104
  8. 810783Domain d1qiub2: 1qiu B:319-395 [28209]
    Other proteins in same PDB: d1qiua1, d1qiub1, d1qiuc1, d1qiud1, d1qiue1, d1qiuf1

Details for d1qiub2

PDB Entry: 1qiu (more details), 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres
PDB Compounds: (B:) adenovirus fibre

SCOP Domain Sequences for d1qiub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qiub2 b.83.1.1 (B:319-395) Adenovirus {Human adenovirus type 2 [TaxId: 10515]}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitignkn

SCOP Domain Coordinates for d1qiub2:

Click to download the PDB-style file with coordinates for d1qiub2.
(The format of our PDB-style files is described here.)

Timeline for d1qiub2: