![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [51212] (31 PDB entries) |
![]() | Domain d1runa2: 1run A:9-137 [28142] Other proteins in same PDB: d1runa1, d1runb1 protein/DNA complex; complexed with cmp |
PDB Entry: 1run (more details), 2.7 Å
SCOPe Domain Sequences for d1runa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1runa2 b.82.3.2 (A:9-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts ekvgnlafl
Timeline for d1runa2: