SCOPe 2.07: Domain d1dgr.2: 1dgr V:,W:

Lineage for d1dgr.2 (1dgr V:,W:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (11 PDB entries)

8. Domain d1dgr.2: 1dgr V:,W: [28099]
   complexed with po4

Details for d1dgr.2

PDB Entry: 1dgr, 2.6 Å

PDB Description: Refined crystal structure of canavalin from jack bean

PDB Compounds: (V:) canavalin, (W:) canavalin

SCOPe Domain Sequences for d1dgr.2:

Sequence; same for both SEQRES and ATOM records:

>g1dgr.2 b.82.1.2 (V:,W:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvgleXmqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaen
nernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqp

Timeline for d1dgr.2:

• d1dgr.2 first appeared (with stable ids) in SCOP 1.55
  
• d1dgr.2 appears in SCOPe 2.06
  
• d1dgr.2 appears in the current release, SCOPe 2.08