Lineage for d1lxaa_ (1lxa A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423280Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (2 proteins)
    this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain
  6. 2423281Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)
  7. 2423282Species Escherichia coli, gene lpxA [TaxId:562] [51164] (6 PDB entries)
  8. 2423287Domain d1lxaa_: 1lxa A: [28052]

Details for d1lxaa_

PDB Entry: 1lxa (more details), 2.6 Å

PDB Description: udp n-acetylglucosamine acyltransferase
PDB Compounds: (A:) udp n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d1lxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxaa_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

SCOPe Domain Coordinates for d1lxaa_:

Click to download the PDB-style file with coordinates for d1lxaa_.
(The format of our PDB-style files is described here.)

Timeline for d1lxaa_: