SCOPe 2.07: Domain d5es3b2: 5es3 B:160-331

Lineage for d5es3b2 (5es3 B:160-331)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226330] (13 PDB entries)

8. Domain d5es3b2: 5es3 B:160-331 [280355]
   Other proteins in same PDB: d5es3a1, d5es3b1, d5es3c1, d5es3d1, d5es3e1, d5es3f1, d5es3g1, d5es3h1
   automated match to d9ldta2
   complexed with oxm

Details for d5es3b2

PDB Entry: 5es3, 2.29 Å

PDB Description: co-crystal structure of ldh liganded with oxamate

PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5es3b2:

Sequence; same for both SEQRES and ATOM records:

>d5es3b2 d.162.1.1 (B:160-331) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgvnvagvslkslnpqlgt
dadkeqwkdvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikedvflsvpcilgqngisdvvkvtltpdeearlkksadtlwgiqkelqf

Timeline for d5es3b2:

• d5es3b2 first appeared in SCOPe 2.05
  
• d5es3b2 appears in SCOPe 2.06
  
• d5es3b2 appears in the current release, SCOPe 2.08