Lineage for d5dkkb_ (5dkk B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577189Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2577190Protein automated matches [190492] (24 species)
    not a true protein
  7. 2577335Species Phaeodactylum tricornutum [TaxId:2850] [280317] (4 PDB entries)
  8. 2577339Domain d5dkkb_: 5dkk B: [280321]
    automated match to d3ue6e_
    complexed with act, edo, fmn

Details for d5dkkb_

PDB Entry: 5dkk (more details), 2.5 Å

PDB Description: structure of the dark-state monomer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum
PDB Compounds: (B:) LOV domain

SCOPe Domain Sequences for d5dkkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dkkb_ d.110.3.0 (B:) automated matches {Phaeodactylum tricornutum [TaxId: 2850]}
sfikalqtaqqnfvvtdpslpdnpivyasqgflnltgysldqilgrncrflqgpetdpka
verirkaieqgndmsvcllnyrvdgttfwnqffiaalrdaggnvtnfvgvqckvsdqyaa
tvtkqqeeeeeaaand

SCOPe Domain Coordinates for d5dkkb_:

Click to download the PDB-style file with coordinates for d5dkkb_.
(The format of our PDB-style files is described here.)

Timeline for d5dkkb_: