Lineage for d4d3cl1 (4d3c L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2371487Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (28 PDB entries)
  8. 2371551Domain d4d3cl1: 4d3c L:1-107 [280298]
    Other proteins in same PDB: d4d3ca1, d4d3cl2
    automated match to d1dn0a1

Details for d4d3cl1

PDB Entry: 4d3c (more details), 2.62 Å

PDB Description: crystal structure of the nk1 domain of hgf in complex with anti-hgf monoclonal antibody sfn68.
PDB Compounds: (L:) sfn68 fab

SCOPe Domain Sequences for d4d3cl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d3cl1 b.1.1.0 (L:1-107) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eldltqtpssvsaavggtvtincqasqsvsnllawyqqkpgqppklliygasnlesgvps
rfrgsgsgteftltisgmkaedaatyycqsgyysagatfgagtnvei

SCOPe Domain Coordinates for d4d3cl1:

Click to download the PDB-style file with coordinates for d4d3cl1.
(The format of our PDB-style files is described here.)

Timeline for d4d3cl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d3cl2
View in 3D
Domains from other chains:
(mouse over for more information)
d4d3ca1